EVPLL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084578
Artikelname: EVPLL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084578
Hersteller Artikelnummer: orb2084578
Alternativnummer: BYT-ORB2084578-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EVPLL
Konjugation: Biotin
EVPLL Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33 kDa
NCBI: 001138599
UniProt: A8MZ36
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LKDLFLDVDKARRLKHPQAEETEKDIEQLHERVTQECAEYCALYEKMVLP