CCDC30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084602
Artikelname: CCDC30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084602
Hersteller Artikelnummer: orb2084602
Alternativnummer: BYT-ORB2084602-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CCDC30
Konjugation: Biotin
Alternative Synonym: PFD6L, PFDN6L
CCDC30 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001074319
UniProt: Q5VVM6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ALKVESEVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILE