WDYHV1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084710
Artikelname: WDYHV1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084710
Hersteller Artikelnummer: orb2084710
Alternativnummer: BYT-ORB2084710-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human WDYHV1
Konjugation: Biotin
Alternative Synonym: WDYHV1, C8orf32
WDYHV1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 006716660
UniProt: E5RHC2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWD