WDR86 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084713
Artikelname: WDR86 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084713
Hersteller Artikelnummer: orb2084713
Alternativnummer: BYT-ORB2084713-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human WDR86
Konjugation: Biotin
WDR86 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 001271189
UniProt: Q86TI4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SADRTVKCWLADTGECVRTFTAHRRNVSALKYHAGTLFTGSGDACARAFD