TSGA10IP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084812
Artikelname: TSGA10IP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084812
Hersteller Artikelnummer: orb2084812
Alternativnummer: BYT-ORB2084812-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSGA10IP
Konjugation: Biotin
Alternative Synonym: FAM161C
TSGA10IP Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 689975
UniProt: Q3SY00
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LGSGDGVPNQDLQQRSQSSRQTAKKDRKPRGQSKKGQGSEESEDHFPLLP