TMPRSS7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084842
Artikelname: TMPRSS7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084842
Hersteller Artikelnummer: orb2084842
Alternativnummer: BYT-ORB2084842-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS7
Konjugation: Biotin
TMPRSS7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 001036040
UniProt: Q7RTY8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG