TMEM202 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084851
Artikelname: TMEM202 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084851
Hersteller Artikelnummer: orb2084851
Alternativnummer: BYT-ORB2084851-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM202
Konjugation: Biotin
TMEM202 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 001073931
UniProt: A6NGA9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSV