SPDYE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084968
Artikelname: SPDYE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084968
Hersteller Artikelnummer: orb2084968
Alternativnummer: BYT-ORB2084968-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPDYE1
Konjugation: Biotin
Alternative Synonym: SPDYE, Ringo1, WBSCR19, SPDYB2L2
SPDYE1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 778234
UniProt: Q8NFV5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILLEHHK