SNRNP40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084986
Artikelname: SNRNP40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084986
Hersteller Artikelnummer: orb2084986
Alternativnummer: BYT-ORB2084986-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SNRNP40
Konjugation: Biotin
Alternative Synonym: 40K, SPF38, WDR57, PRP8BP, HPRP8BP, PRPF8BP
SNRNP40 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 004805
UniProt: Q96DI7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT