MIEF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084992
Artikelname: MIEF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084992
Hersteller Artikelnummer: orb2084992
Alternativnummer: BYT-ORB2084992-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMCR7
Konjugation: Biotin
Alternative Synonym: MID49, SMCR7, COXPD49
MIEF2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
UniProt: Q96C03
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSS