SERINC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085019
Artikelname: SERINC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085019
Hersteller Artikelnummer: orb2085019
Alternativnummer: BYT-ORB2085019-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SERINC4
Konjugation: Biotin
SERINC4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 001244961
UniProt: A6NH21
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH