RIIAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085058
Artikelname: RIIAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085058
Hersteller Artikelnummer: orb2085058
Alternativnummer: BYT-ORB2085058-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RIIAD1
Konjugation: Biotin
Alternative Synonym: C1orf230, NCRNA00166
RIIAD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 001138428
UniProt: A6NNX1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREI