RBMXL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085076
Artikelname: RBMXL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085076
Hersteller Artikelnummer: orb2085076
Alternativnummer: BYT-ORB2085076-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBMXL1
Konjugation: Biotin
Alternative Synonym: RBM1
RBMXL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 062556
UniProt: Q96E39
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRG