RAPGEFL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085085
Artikelname: RAPGEFL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085085
Hersteller Artikelnummer: orb2085085
Alternativnummer: BYT-ORB2085085-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAPGEFL1
Konjugation: Biotin
Alternative Synonym: Link-GEFII
RAPGEFL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
UniProt: Q9UHV5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KFKNLFRKFENLTDPCRNHKSYREVISKMKPPVIPFVPLILKDLTFLHEG