PUS7L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085100
Artikelname: PUS7L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085100
Hersteller Artikelnummer: orb2085100
Alternativnummer: BYT-ORB2085100-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PUS7L
Konjugation: Biotin
PUS7L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 112582
UniProt: Q9H0K6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK