OVCH2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085262
Artikelname: OVCH2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085262
Hersteller Artikelnummer: orb2085262
Alternativnummer: BYT-ORB2085262-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human OVCH2
Konjugation: Biotin
Alternative Synonym: OVTN
OVCH2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
UniProt: Q7RTZ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDCTSDYVTV