OR52B6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085298
Artikelname: OR52B6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085298
Hersteller Artikelnummer: orb2085298
Alternativnummer: BYT-ORB2085298-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52B6
Konjugation: Biotin
Alternative Synonym: OR11-47
OR52B6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 001005162
UniProt: Q8NGF0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VWYGLAAALLSTGLDIMLITVSYIHILQAVFRLLSQDARSKALSTCGSHI