OR52B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085301
Artikelname: OR52B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085301
Hersteller Artikelnummer: orb2085301
Alternativnummer: BYT-ORB2085301-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52B2
Konjugation: Biotin
Alternative Synonym: OR11-70
OR52B2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 001004052
UniProt: Q96RD2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFT