OR10R2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085331
Artikelname: OR10R2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085331
Hersteller Artikelnummer: orb2085331
Alternativnummer: BYT-ORB2085331-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10R2
Konjugation: Biotin
Alternative Synonym: OR1-8, OR10R2Q
OR10R2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 001004472
UniProt: Q8NGX6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VPFLFICVSYLCILRTILKIPSAEGRRKAFSTCASHLSVVIVHYGCASFI