OR11H12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085388
Artikelname: OR11H12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085388
Hersteller Artikelnummer: orb2085388
Alternativnummer: BYT-ORB2085388-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OR11H12
Konjugation: Biotin
OR11H12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 001013372
UniProt: B2RN74
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YAFIFITVMKMPSTGGRKKAFSTCASHLTAITIFHGTILFLYCVPNSKSS