OR7A17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085502
Artikelname: OR7A17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085502
Hersteller Artikelnummer: orb2085502
Alternativnummer: BYT-ORB2085502-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7A17
Konjugation: Biotin
Alternative Synonym: HTPCRX19, BC85395_4
OR7A17 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 112163
UniProt: O14581
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYS