OR5K4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085535
Artikelname: OR5K4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085535
Hersteller Artikelnummer: orb2085535
Alternativnummer: BYT-ORB2085535-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5K4
Konjugation: Biotin
OR5K4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 001005517
UniProt: A6NMS3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IYIFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFSTCASHFLSV