OR4S1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085604
Artikelname: OR4S1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085604
Hersteller Artikelnummer: orb2085604
Alternativnummer: BYT-ORB2085604-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4S1
Konjugation: Biotin
Alternative Synonym: OR11-100
OR4S1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 001004725
UniProt: Q8NGB4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGSHVITVL