OPLAH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085727
Artikelname: OPLAH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085727
Hersteller Artikelnummer: orb2085727
Alternativnummer: BYT-ORB2085727-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OPLAH
Konjugation: Biotin
Alternative Synonym: OPLA, OPLAHD, 5-Opase
OPLAH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 141kDa
NCBI: 060040
UniProt: O14841
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDG