N4BP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085811
Artikelname: N4BP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085811
Hersteller Artikelnummer: orb2085811
Alternativnummer: BYT-ORB2085811-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human N4BP3
Konjugation: Biotin
Alternative Synonym: LZTS4
N4BP3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 055926
UniProt: O15049
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKT