N4BP2L1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085817
Artikelname: N4BP2L1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085817
Hersteller Artikelnummer: orb2085817
Alternativnummer: BYT-ORB2085817-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human N4BP2L1
Konjugation: Biotin
Alternative Synonym: CG018
N4BP2L1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 438169
UniProt: Q5TBK1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNARYW