MTSS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085838
Artikelname: MTSS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085838
Hersteller Artikelnummer: orb2085838
Alternativnummer: BYT-ORB2085838-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MTSS1L
Konjugation: Biotin
Alternative Synonym: ABBA, ABBA1, ABBA-1, MTSS1L
MTSS1L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
UniProt: Q765P7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKGKGDLQPQLD