MRPS25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085847
Artikelname: MRPS25 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085847
Hersteller Artikelnummer: orb2085847
Alternativnummer: BYT-ORB2085847-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS25
Konjugation: Biotin
Alternative Synonym: RPMS25, COXPD50, MRP-S25
MRPS25 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 071942
UniProt: P82663
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD