LRRC37A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085943
Artikelname: LRRC37A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085943
Hersteller Artikelnummer: orb2085943
Alternativnummer: BYT-ORB2085943-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human LRRC37A2
Konjugation: Biotin
Alternative Synonym: LRRC37
LRRC37A2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 001006608
UniProt: A6NM11
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RESQDGLSSFGQPLWFKDLYKPLSATRINNHAWKLHKKSSNEDKILNRDP