KRT84 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086003
Artikelname: KRT84 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086003
Hersteller Artikelnummer: orb2086003
Alternativnummer: BYT-ORB2086003-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human KRT84
Konjugation: Biotin
Alternative Synonym: HB4, KRTHB4
KRT84 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 149034
UniProt: Q9NSB2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQK