KRT34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086027
Artikelname: KRT34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086027
Hersteller Artikelnummer: orb2086027
Alternativnummer: BYT-ORB2086027-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT34
Konjugation: Biotin
Alternative Synonym: HA4, K34, Ha-4, hHa4, KRTHA4
KRT34 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 003403930
UniProt: O76011
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPC