KRT34 Rabbit Polyclonal Antibody (Biotin)
Artikelnummer:
BYT-ORB2086030
| Artikelname: |
KRT34 Rabbit Polyclonal Antibody (Biotin) |
| Artikelnummer: |
BYT-ORB2086030 |
| Hersteller Artikelnummer: |
orb2086030 |
| Alternativnummer: |
BYT-ORB2086030-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human KRT34 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
HA4, K34, Ha-4, hHa4, KRTHA4 |
| KRT34 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
47kDa |
| NCBI: |
003403930 |
| UniProt: |
O76011 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AKAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESDINSIRRILDEL |