CCDC183 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086063
Artikelname: CCDC183 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086063
Hersteller Artikelnummer: orb2086063
Alternativnummer: BYT-ORB2086063-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC183
Konjugation: Biotin
Alternative Synonym: PARF, KIAA1984, bA216L13.7
CCDC183 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
UniProt: Q5T5S1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HLVRRRGQKLESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIK