TESPA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086105
Artikelname: TESPA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086105
Hersteller Artikelnummer: orb2086105
Alternativnummer: BYT-ORB2086105-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESPA1
Konjugation: Biotin
Alternative Synonym: HSPC257, ITPRID3, KIAA0748
TESPA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 005269304
UniProt: A2RU30
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF