IZUMO2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086156
Artikelname: IZUMO2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086156
Hersteller Artikelnummer: orb2086156
Alternativnummer: BYT-ORB2086156-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IZUMO2
Konjugation: Biotin
Alternative Synonym: SCRL, C19orf41, PLAL6978, PRO21961
IZUMO2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 689571
UniProt: Q6UXV1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV