INTS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086180
Artikelname: INTS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086180
Hersteller Artikelnummer: orb2086180
Alternativnummer: BYT-ORB2086180-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INTS2
Konjugation: Biotin
Alternative Synonym: INT2, KIAA1287
INTS2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 065799
UniProt: Q9H0H0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL