HIGD2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086225
Artikelname: HIGD2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086225
Hersteller Artikelnummer: orb2086225
Alternativnummer: BYT-ORB2086225-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIGD2A
Konjugation: Biotin
Alternative Synonym: RCF1b
HIGD2A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 620175
UniProt: Q9BW72
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGN