FAM131A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086429
Artikelname: FAM131A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086429
Hersteller Artikelnummer: orb2086429
Alternativnummer: BYT-ORB2086429-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM131A
Konjugation: Biotin
Alternative Synonym: C3orf40, FLAT715, PRO1378
FAM131A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 653236
UniProt: G5E9B1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASS