PCED1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086450
Artikelname: PCED1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086450
Hersteller Artikelnummer: orb2086450
Alternativnummer: BYT-ORB2086450-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCED1B
Konjugation: Biotin
Alternative Synonym: FAM113B
PCED1B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 612380
UniProt: Q96HM7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQANRNHPAL