FAM108C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086456
Artikelname: FAM108C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086456
Hersteller Artikelnummer: orb2086456
Alternativnummer: BYT-ORB2086456-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAM108C1
Konjugation: Biotin
Alternative Synonym: FAM108C1
FAM108C1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 067037
UniProt: Q6PCB6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENI