CBWD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087179
Artikelname: CBWD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087179
Hersteller Artikelnummer: orb2087179
Alternativnummer: BYT-ORB2087179-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CBWD3
Konjugation: Biotin
Alternative Synonym: bA561O23.1
CBWD3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 958861
UniProt: Q6VB91
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQGVHELYDLEETPVSWKDDTERTNRLVLIGRNLDKDILKQLFIATVTET