TMEM199 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087281
Artikelname: TMEM199 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087281
Hersteller Artikelnummer: orb2087281
Alternativnummer: BYT-ORB2087281-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TMEM199
Konjugation: Biotin
Alternative Synonym: VPH2, CDG2P, VMA12, C17orf32
TMEM199 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 689677
UniProt: Q8N511
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVR