LRRC74A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087305
Artikelname: LRRC74A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087305
Hersteller Artikelnummer: orb2087305
Alternativnummer: BYT-ORB2087305-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C14orf166B
Konjugation: Biotin
Alternative Synonym: LRRC74, C14orf166B
LRRC74A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 919263
UniProt: Q0VAA2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKPARENSETDLEIEDDE