CARNMT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087335
Artikelname: CARNMT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087335
Hersteller Artikelnummer: orb2087335
Alternativnummer: BYT-ORB2087335-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C9orf41
Konjugation: Biotin
Alternative Synonym: C9orf41, UPF0586
CARNMT1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 689633
UniProt: Q8N4J0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN