C9orf116 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087338
Artikelname: C9orf116 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087338
Hersteller Artikelnummer: orb2087338
Alternativnummer: BYT-ORB2087338-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf116
Konjugation: Biotin
Alternative Synonym: PIERCE1, RbEST47
C9orf116 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 001041730
UniProt: Q5BN46
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL