TPRA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087344
Artikelname: TPRA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087344
Hersteller Artikelnummer: orb2087344
Alternativnummer: BYT-ORB2087344-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TPRA1
Konjugation: Biotin
Alternative Synonym: GPR175, TPRA40, TMEM227
TPRA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 001129525
UniProt: Q86W33
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE