MIR1-1HG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087359
Artikelname: MIR1-1HG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087359
Hersteller Artikelnummer: orb2087359
Alternativnummer: BYT-ORB2087359-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C20orf166
Konjugation: Biotin
Alternative Synonym: C20orf166, MIR133A2HG
MIR1-1HG Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 848558
UniProt: Q9H1L0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QQVARGEPGSARGQLQVSPEMSITHKEKENAHLKEILLFVNAEAFSQPQP