SNX20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087371
Artikelname: SNX20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087371
Hersteller Artikelnummer: orb2087371
Alternativnummer: BYT-ORB2087371-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNX20
Konjugation: Biotin
Alternative Synonym: SLIC1
SNX20 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 699168
UniProt: Q7Z614
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKV