AGAP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087401
Artikelname: AGAP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087401
Hersteller Artikelnummer: orb2087401
Alternativnummer: BYT-ORB2087401-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AGAP5
Konjugation: Biotin
Alternative Synonym: CTGLF2
AGAP5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 001137472
UniProt: A6NIR3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EMPEDIPLEPNPSDHPKASTIFLRKSQTDVQEKKKKQLCKVSTEHFTQQY