C10orf71 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087410
Artikelname: C10orf71 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087410
Hersteller Artikelnummer: orb2087410
Alternativnummer: BYT-ORB2087410-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C10orf71
Konjugation: Biotin
Alternative Synonym: CEFIP
C10orf71 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 79kDa
UniProt: Q711Q0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AERSSYENKEVEGELEMGPAGSSWCPDSREHRPRKHLSLRLCNRDPEPGG